WHOIS Record for Ausablevalleygrangefarmersmarkets.com
WHOIS History WHOIS Research Similar Domains Reverse IP Address
Domain Dates
Creation Date: | WHOIS History | |
---|---|---|
Updated Date: | WHOIS History | |
Expiration Date: | WHOIS History |
Registrant Contact
Name: | Whois Privacy Protection Service by onamae.com | ~6,439 domains |
---|---|---|
Organization: | Whois Privacy Protection Service by onamae.com | ~6,439 domains |
Email: | @whoisprotectservice.com | ~6,837 domains |
Phone: | +81.354562560 | ~6,194 domains |
Street: | 26-1 Sakuragaoka-cho Cerulean Tower 11F | ~7,748 domains |
City: | Shibuya-ku | ~9,608 domains |
State Province: | Tokyo | ~15,414 domains |
Postal Code: | 150-8512 | ~8,999 domains |
Country: | Japan | ~35,981 domains |
Address: | 26-1 Sakuragaoka-cho, Cerulean Tower 11F, Shibuya-ku, Tokyo, 150-8512, Japan | ~5,042 domains |
Admin Contact
Name: | Whois Privacy Protection Service by onamae.com | ~6,439 domains |
---|---|---|
Organization: | Whois Privacy Protection Service by onamae.com | ~6,439 domains |
Email: | @whoisprotectservice.com | ~6,837 domains |
Phone: | +81.354562560 | ~6,194 domains |
Street: | 26-1 Sakuragaoka-cho | ~8,279 domains |
City: | Shibuya-ku | ~9,608 domains |
State Province: | Tokyo | ~15,414 domains |
Postal Code: | 150-8512 | ~8,999 domains |
Country: | Japan | ~35,981 domains |
Address: | 26-1 Sakuragaoka-cho, Shibuya-ku, Tokyo, 150-8512, Japan | ~5,709 domains |
Tech Contact
Name: | Whois Privacy Protection Service by onamae.com | ~6,439 domains |
---|---|---|
Organization: | Whois Privacy Protection Service by onamae.com | ~6,439 domains |
Email: | @whoisprotectservice.com | ~6,837 domains |
Phone: | +81.354562560 | ~6,194 domains |
Street: | 26-1 Sakuragaoka-cho | ~8,279 domains |
City: | Shibuya-ku | ~9,608 domains |
State Province: | Tokyo | ~15,414 domains |
Postal Code: | 150-8512 | ~8,999 domains |
Country: | Japan | ~35,981 domains |
Address: | 26-1 Sakuragaoka-cho, Shibuya-ku, Tokyo, 150-8512, Japan | ~5,709 domains |
Registrar
Registrar: | GMO Internet, Inc. | ~20,464 domains |
---|---|---|
Url: | http://www.onamae.com | ~26,966 domains |
Whois Server: | whois.discount-domain.com | ~27,610 domains |
Abuse Email: | @gmo.jp | ~22,182 domains |
Abuse Phone: | +81.337709199 | ~22,024 domains |
Iana Id: | 49 | ~23,449 domains |
Domain Status
clientTransferProhibited [?] | ~1,344,407 domains |
Name Servers
ns1.sedoparking.com () | ~20,929 domains |
ns2.sedoparking.com () | ~20,928 domains |
Raw WHOIS Record ( last updated on )
Domain Name: ausablevalleygrangefarmersmarkets.com Registry Domain ID: 2781105358_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.discount-domain.com Registrar URL: http://www.onamae.com Updated Date: 2023-07-18T15:20:52Z Creation Date: 2023-05-15T18:04:44Z Registrar Registration Expiration Date: 2025-05-15T18:04:44Z Registrar: GMO INTERNET, INC. Registrar IANA ID: 49 Registrar Abuse Contact Email: @gmo.jp Registrar Abuse Contact Phone: +81.337709199 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Whois Privacy Protection Service by onamae.com Registrant Organization: Whois Privacy Protection Service by onamae.com Registrant Street: 26-1 Sakuragaoka-cho Registrant Street: Cerulean Tower 11F Registrant City: Shibuya-ku Registrant State/Province: Tokyo Registrant Postal Code: 150-8512 Registrant Country: JP Registrant Phone: +81.354562560 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: @whoisprotectservice.com Registry Admin ID: Not Available From Registry Admin Name: Whois Privacy Protection Service by onamae.com Admin Organization: Whois Privacy Protection Service by onamae.com Admin Street: 26-1 Sakuragaoka-cho Admin Street: Cerulean Tower 11F Admin City: Shibuya-ku Admin State/Province: Tokyo Admin Postal Code: 150-8512 Admin Country: JP Admin Phone: +81.354562560 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: @whoisprotectservice.com Registry Tech ID: Not Available From Registry Tech Name: Whois Privacy Protection Service by onamae.com Tech Organization: Whois Privacy Protection Service by onamae.com Tech Street: 26-1 Sakuragaoka-cho Tech Street: Cerulean Tower 11F Tech City: Shibuya-ku Tech State/Province: Tokyo Tech Postal Code: 150-8512 Tech Country: JP Tech Phone: +81.354562560 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: @whoisprotectservice.com Name Server: ns1.sedoparking.com Name Server: ns2.sedoparking.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-07-18T15:20:52Z <<< For more information on Whois status codes, please visit https://icann.org/epp